FIMA
Data Integration Module
In UniProt:      " Crepis albida "
                                        Results:
1 - 2 - 3 - 4 - 5 - 6
Uniprot entry: P86166
Protein Name: Turripeptide Pal9a
Sequence (FASTA):>Turripeptide Pal9a
NVCDGDACPDGVCRSGCTCDFNVAQRKDTCFYPQ
See the full UniProt entry: P86166
FIMA Data Integration Module is based on an expanded and improved version of the algorithm reported in the following reference.
Primary citation: Abdelkrim Rachedi et al., GABAagent: a system for integrating data on GABA receptors. Bioinformatics. 2000 Apr;16(4):301-12.