FIMA Data Integration Module

FIMA
Data Integration Module

In UniProt: " Crepis albida "

Results:

1 - 2 - 3 - 4 - 5 - 6

Uniprot entry: P0DKT1

Protein Name: Turripeptide Pal9.2

Sequence (FASTA):>Turripeptide Pal9.2
MKVYCLLVVLLVGLVSQTQGQLDKKCNMACTLDYRPVCGSDGKTYPNRCALTSTACESQQSITVLHDGEC

See the full UniProt entry: P0DKT1

FIMA Data Integration Module is based on an expanded and improved version of the algorithm reported in the following reference. Primary citation: Abdelkrim Rachedi et al., GABAagent: a system for integrating data on GABA receptors. Bioinformatics. 2000 Apr;16(4):301-12.