FIMA Data Integration Module

FIMA
Data Integration Module

In UniProt: " Euphorbia gnyoniana "

Results:

01 - 02 - 03 - 04 - 05 - 06 - 07 - 08 - 09 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - 20 - 21 - 22 - 23 - 24 - 25 - 26 - 27 - 28

Uniprot entry: P69568

Protein Name: Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC 4.1.1.39) (Fragment)

Sequence (FASTA):>Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC 4.1.1.39) (Fragment)
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVA

See the full UniProt entry: P69568

FIMA Data Integration Module is based on an expanded and improved version of the algorithm reported in the following reference. Primary citation: Abdelkrim Rachedi et al., GABAagent: a system for integrating data on GABA receptors. Bioinformatics. 2000 Apr;16(4):301-12.