BRAID
Data Integration Module
In UniProt:      " Kanamycin "
                                        Results:
01 - 02 - 03 - 04 - 05 - 06 - 07 - 08 - 09 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - 20 - 21 - 22 - 23 - 24 - 25
Uniprot entry: P69913
Protein Name: Carbon storage regulator (Translational dual regulator CsrA)
Sequence (FASTA):>Carbon storage regulator (Translational dual regulator CsrA)
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY
Related protein structures: - 1Y00 - 5Z38
See the full UniProt entry: P69913
BRAID Data Integration Module is based on an improved version of the algorithm reported in the following reference.
Primary citation: Abdelkrim Rachedi et al., GABAagent: a system for integrating data on GABA receptors. Bioinformatics. 2000 Apr;16(4):301-12.